HPA002730

BAZ1A antibody from Sigma-Aldrich
ACF1, hACF1, WALp1, WCRF180
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002730
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002730, RRID:AB_1078269
Product name
Anti-BAZ1A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002730
Antibody type
Polyclonal
Antigen
Bromodomain adjacent to zinc finger domain protein 1A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RGHRESALKETLLQEKSRICAQLARFSEEKFHFSD
KPQPDSKPTYSRGRSSNAYDPSQMCAEKQLELRLR
DFLLDIEDRIYQGTLGAIKVTDRHIWRSALESGRY
ELLSEENKENGIIKTVNEDVEEMEIDEQTK
Storage
-20C
Provider Type Product Number
- No reagents -