HPA023286

ZMYND15 antibody from Sigma-Aldrich
DKFZp434N127
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023286
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023286, RRID:AB_1859076
Product name
Anti-ZMYND15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023286
Antibody type
Polyclonal
Antigen
Zinc finger MYND domain-containing protein 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PGFTFASLRARTCHVCHRHSFEAKLTPCPQCSAVL
YCGEACLRADWQRCPDDVSHRFWCPRLAAFMERAG
ELATLPFTYTAEVTSETF
Storage
-20C
Provider Type Product Number
- No reagents -