Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [3]
- Proximity ligation assay [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005894-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005894-M03, RRID:AB_913847
- Product name
- RAF1 monoclonal antibody (M03), clone 1H4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RAF1.
- Antigen sequence
MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQ
FGYQRRASDDGKLTDPSKTSNTIRVFLPNKQRTVV
NVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEH
KGKKARLDWNTDAASLIGEELQVDF- Isotype
- IgG
- Antibody clone number
- 1H4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of RAF1 expression in transfected 293T cell line by RAF1 monoclonal antibody (M03), clone 1H4.Lane 1: RAF1 transfected lysate(73.1 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RAF1 monoclonal antibody (M03), clone 1H4. Western Blot analysis of RAF1 expression in HeLa.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RAF1 monoclonal antibody (M03), clone 1H4. Western Blot analysis of RAF1 expression in rat brain.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between PDGFRB and RAF1. Huh7 cells were stained with anti-PDGFRB rabbit purified polyclonal 1:600 and anti-RAF1 mouse monoclonal antibody 1:100. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between BAD and RAF1. HeLa cells were stained with anti-BAD rabbit purified polyclonal 1:1200 and anti-RAF1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)