HPA002640

RAF1 antibody from Sigma-Aldrich
c-Raf, CRAF, Raf-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002640
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002640, RRID:AB_1856047
Product name
Anti-RAF1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002640
Antibody type
Polyclonal
Antigen
RAF proto-oncogene serine/threonine-protein kinase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFP
NSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRY
STPHAFTFNTSSPSSEGSLSQRQRSTSTPNVHMVS
TTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSP
TGWSQ
Storage
-20C
Provider Type Product Number
- No reagents -