HPA003565

PAK1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003565
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003565, RRID:AB_1854935
Product name
Anti-PAK1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003565
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase PAK 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NSQKYMSFTDKSAEDYNSSNALNVKAVSETPAVPP
VSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIE
PLPVTPTRDVATSPISPTENNTTPPDALTRNTEKQ
KKKPKMSDEE
Storage
-20C
Provider Type Product Number
- No reagents -