HPA023312

PSMB6 antibody from Sigma-Aldrich
DELTA, Y
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023312
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023312, RRID:AB_1855828
Product name
Anti-PSMB6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023312
Antibody type
Polyclonal
Antigen
Proteasome subunit beta type-6 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAATLLAARGAGPAPAWGPEAFTPDWESREVSTGT
TIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLT
Storage
-20C
Provider Type Product Number
- No reagents -