Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000699-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000699-M02, RRID:AB_464015
- Product name
- BUB1 monoclonal antibody (M02), clone 2F9
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BUB1.
- Antigen sequence
MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVE
ENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFIS
YCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAW
AGHLEAQGELQHASAVLQRGIQNQA- Isotype
- IgG
- Antibody clone number
- 2F9
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BUB1 monoclonal antibody (M02), clone 2F9 Western Blot analysis of BUB1 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of BUB1 expression in transfected 293T cell line by BUB1 monoclonal antibody (M02), clone 2F9.Lane 1: BUB1 transfected lysate(122 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged BUB1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of BUB1 transfected lysate using anti-BUB1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with BUB1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol