HPA006123

BUB1 antibody from MilliporeSigma / Merck KGaA
BUB1A, BUB1L, hBUB1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006123
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA006123, RRID:AB_1845498
Product name
Anti-BUB1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA006123
Antibody type
Polyclonal
Antigen
Mitotic checkpoint serine/threonine-protein kinase BUB1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SCEENMVVPSRDGKFSPIQEKSPKQALSSHMYSAS
LLRLSQPAAGGVLTCEAELGVEACRLTDTDAAIAE
DPPDAIAGLQAEWMQMSSLGTVDAPNFIVGNPWDD
KLIFKLLSGLSKPVSSYPNTFEWQCKLPAIKPKTE
F
Storage
-20C
Provider Type Product Number
- No reagents -