HPA003387

CDK1 antibody from Sigma-Aldrich
CDC2, CDC28A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003387
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003387, RRID:AB_1846356
Product name
Anti-CDC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003387
Antibody type
Polyclonal
Antigen
Cell division control protein 2 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEI
DQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWK
PGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKM
ALNHPYFNDLDNQIKKM
Storage
-20C
Provider Type Product Number
- No reagents -