ABIN629980

antibody from antibodies-online

Targeting: CPNE1 CPN1

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: ABIN629980 - Provider product page
Provider: antibodies-online
Product name: anti-Copine I (CPNE1) (N-Term) antibody
Antibody type: Polyclonal
Antigen: Copine I antibody was raised using the N terminal of CPNE1 corresponding to a region with amino acids TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG
Description: Purified
Reactivity: Human
Host: Rabbit
Epitope: N-Term
Vial size: 100 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

CPNE1 protein structure - ABIN629980 shown in red.