HPA003928

CDC37 antibody from Atlas Antibodies
P50CDC37
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003928
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003928, RRID:AB_1846373
Product name
Anti-CDC37
Provider product page
Atlas Antibodies - HPA003928
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYE
KQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLV
IWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSL
KVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKE
RV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -