HPA003928

CDC37 antibody from Sigma-Aldrich
P50CDC37
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003928
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003928, RRID:AB_1846373
Product name
Anti-CDC37 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003928
Antibody type
Polyclonal
Antigen
Hsp90 co-chaperone Cdc37 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYE
KQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLV
IWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSL
KVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKE
RV
Storage
-20C
Provider Type Product Number
- No reagents -