HPA003508

ASB1 antibody from Sigma-Aldrich
ASB-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003508
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003508, RRID:AB_1845065
Product name
Anti-ASB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003508
Antibody type
Polyclonal
Antigen
Ankyrin repeat and SOCS box protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVDVKGQTALYVAVVNGHLESTQILLEAGADPNGS
RHHRSTPVYHASRVGRADILKALIRYGADVDVNHH
LTPDVQPRFSRRLTSLVVCPLYISAAYHNLQCFRL
LLLAGANPDFNCNGPVNTQGFYRGSPGCVMDAVL
Storage
-20C
Provider Type Product Number
- No reagents -