HPA021167

SLC25A11 antibody from Sigma-Aldrich
OGC, SLC20A4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021167
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021167, RRID:AB_1857021
Product name
Anti-SLC25A11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021167
Antibody type
Polyclonal
Antigen
Mitochondrial 2-oxoglutarate/malate carrier protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFL
LKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPA
DQRRGYK
Storage
-20C
Provider Type Product Number
- No reagents -