HPA026605

DAAM1 antibody from Sigma-Aldrich
KIAA0666
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026605
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026605, RRID:AB_1847464
Product name
Anti-DAAM1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026605
Antibody type
Polyclonal
Antigen
Disheveled-associated activator of morphogenesis 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QNDKGQDPDSTPLENFNIKNVVRMLVNENEVKQWK
EQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMM
QTLNKMKEKLEKETTEHKQVKQQVADLTAQLHELS
RRAVCASIPG
Storage
-20C
Provider Type Product Number
- No reagents -