H00009975-D01P

NR1D2 antibody from Abnova Corporation
BD73, EAR-1r, Hs.37288, HZF2, REVERBB, REVERBbeta, RVR

Antibody data

Product number
H00009975-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009975-D01P, RRID:AB_1578162
Product name
NR1D2 purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00009975-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human NR1D2 protein.
Antigen sequence
MEVNAGGVIAYISSSSSASSHASCHSEGSENSFQS
SSSSVPSSPNSSNSDTNGNPKNGDLANIEGILKND
RIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKV
CGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKC
LKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVR
FGRIPKREKQRMLIEMQSAMKTMMNSQFSGHLQND
TLVEHHEQTALPAQEQLRPKPQLEQENIKSSSPPS
SDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQ
PKRGERIRKNMEQYNLNHDHCGNGLSSHFPCSESQ
QHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAY
TQRVCDRVPIDGFSQNENKNSYLCNTGGRMHLVCP
MSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFA
KRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFD
AKERTVTFLSGKKYSVDDLHSMGAGDLLNSMFEFS
EKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSV
EALQETLIRALRTLIMKNHPNEASIFTKLLLKLPD
LRSLNNMHSEELLAFKVHP
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -