HPA003293

WSB1 antibody from Atlas Antibodies
DKFZp564A122, DKFZp564B0482, SWIP1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003293
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003293, RRID:AB_1858863
Product name
Anti-WSB1
Provider product page
Atlas Antibodies - HPA003293
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
APFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLV
PWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQK
NKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEW
HRFRFGQDQLLLATGLNNGRIKIWDV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -