HPA003293

WSB1 antibody from Sigma-Aldrich
DKFZp564A122, DKFZp564B0482, SWIP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003293
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003293, RRID:AB_1858863
Product name
Anti-WSB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003293
Antibody type
Polyclonal
Antigen
WD repeat and SOCS box-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLV
PWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQK
NKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEW
HRFRFGQDQLLLATGLNNGRIKIWDV
Storage
-20C
Provider Type Product Number
- No reagents -