HPA023818

DNAJB5 antibody from Sigma-Aldrich
Hsc40
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023818
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023818, RRID:AB_1847793
Product name
Anti-DNAJB5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023818
Antibody type
Polyclonal
Antigen
DnaJ homolog subfamily B member 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FHYTFHGDPHATFASFFGGSNPFDIFFASSRSTRP
FSGFDPDDMDVDEDEDPFGAFGRFGFNGLSRGPRR
APEPLYPRRKVQDPPVVHELRVSLEEIYHGSTK
Storage
-20C
Provider Type Product Number
- No reagents -