HPA004144

RBM23 antibody from Sigma-Aldrich
CAPERbeta, FLJ10482, RNPC4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA004144
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA004144, RRID:AB_1079747
Product name
Anti-RBM23 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA004144
Antibody type
Polyclonal
Antigen
Probable RNA-binding protein 23 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYP
SNTTSSTSNSGNETSGSSTIGETSNRSRDRDRYRR
RNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRRE
DRVHYRSPPLATGYRYGHSKSPHFREKSP
Storage
-20C
Provider Type Product Number
- No reagents -