WH0001161M1

ERCC8 antibody from MilliporeSigma / Merck KGaA
CKN1, CSA
ELISA
Recommended by provider

Antibody data

Product number
WH0001161M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0001161M1, RRID:AB_1841501
Product name
Monoclonal Anti-ERCC8 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0001161M1
Antibody type
Monoclonal
Antigen
ERCC8 (AAH09793, a.a. 1-206) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MLGFLSARQTGLEDPLRLRRAESTRRVLGLELNKD
RDVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVL
YDLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETV
QWYPHDTGMFTSSSFDKTLKVWDTNTLQTADVFNF
EETVYSHHMSPVSTKHCLVAVGTRGPKVQLCDLKS
GSCSHILQGIFILFQTATTLSKRFNKKKRY* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -