Antibody data

Product number
H00001161-B02P
Provider
Abnova Corporation
Product name
ERCC8 purified MaxPab mouse polyclonal antibody (B02)
Provider product page
Abnova Corporation - H00001161-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ERCC8 protein.
Antigen sequence
MLGFLSARQTGLEDPLRLRRAESTRRVLGLELNKD
RDVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVL
YDLENSSRQSYYTCKAVCSIGRDHPDVHRYSVETV
QWYPHDTGMFTSSSFDKTLKVWDTNTLQTADVFNF
EETVYSHHMSPVSTKHCLVAVGTRGPKVQLCDLKS
GSCSHILQGHRQEILAVSWSPRYDYILATASADSR
VKLWDVRRASGCLITLDQHNGKKSQAVESANTAHN
GKVNGLCFTSDGLHLLTVGTDNRMRLWNSSNGENT
LVNYGKVCNNSKKGLKFTVSCGCSSEFVFVPYGST
IAVYTVYSGEQITMLKGHYKTVDCCVFQSNFQELY
SGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAF
EDAWSSSDEEG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -