HPA019059

SLC23A3 antibody from Sigma-Aldrich
FLJ31168, SVCT3, Yspl1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019059
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019059, RRID:AB_1857017
Product name
Anti-SLC23A3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019059
Antibody type
Polyclonal
Antigen
Solute carrier family 23 member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IPGTQLERGLGQGLPSPFTAQEARMPQKPREKAAQ
VYRLPFPIQNLCPCIPQPLHCLCPLPEDPGDEEGG
SSEPEEMADLLPGSGEPCPESSREGFRSQ
Storage
-20C
Provider Type Product Number
- No reagents -