Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB29396 - Provider product page
- Provider
- Abnova Corporation
- Product name
- UBE2L6 polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant human UBE2L6.
- Antigen sequence
NLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFP
PEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSE
NWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADL
LTQNPELFRKNAEEFTLR- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate) Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells) with UBE2L6 polyclonal antibody (Cat # PAB29396) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 with UBE2L6 polyclonal antibody (Cat # PAB29396) at 1-4 ug/mL concentration shows positivity in cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder with UBE2L6 polyclonal antibody (Cat # PAB29396) shows strong cytoplasmic and nuclear positivity in urothelial cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)