Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009246-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009246-M01, RRID:AB_425800
- Product name
- UBE2L6 monoclonal antibody (M01), clone 2F12-1F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant UBE2L6.
- Antigen sequence
MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVW
HALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKF
TTKIYHPNVDENGQICLPIISSENWKPCTKTCQVL
EALNVLVNRPNIREPLRMDLADLLTQNPELFRKNA
EEFTLRFGVDRPS- Isotype
- IgG
- Antibody clone number
- 2F12-1F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Interactions between PBEF and oxidative stress proteins--a potential new mechanism underlying PBEF in the pathogenesis of acute lung injury.
Zhang LQ, Adyshev DM, Singleton P, Li H, Cepeda J, Huang SY, Zou X, Verin AD, Tu J, Garcia JG, Ye SQ
FEBS letters 2008 Jun 11;582(13):1802-8
FEBS letters 2008 Jun 11;582(13):1802-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of UBE2L6 expression in transfected 293T cell line by UBE2L6 monoclonal antibody (M01), clone 2F12-1F4.Lane 1: UBE2L6 transfected lysate(17.595 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged UBE2L6 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol