HPA003328

UBE2L6 antibody from Sigma-Aldrich
UBCH8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003328
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003328, RRID:AB_1858539
Product name
Anti-UBE2L6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003328
Antibody type
Polyclonal
Antigen
Ubiquitin/ISG15-conjugating enzyme E2 L6 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFP
PEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSE
NWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADL
LTQNPELFRKNAEEFTLR
Storage
-20C
Provider Type Product Number
- No reagents -