H00008665-B01P

EIF3F antibody from Abnova Corporation
eIF3-epsilon, eIF3-p47, eIF3f, EIF3S5

Antibody data

Product number
H00008665-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008665-B01P, RRID:AB_1573396
Product name
EIF3S5 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00008665-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human EIF3S5 protein.
Antigen sequence
MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAA
APVPAAAPASSSDPAAAAAATAAPGQTPASAQAPA
QTPAPALPGPALPGPFPGGRVVRLHPVILASIVDS
YERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHN
ESEDEVAVDMEFAKNMYELHKKVSPNELILGWYAT
GHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGR
MSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTE
RIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQ
DALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQV
PKIVPDDFETMLNSNINDLLMVTYLANLTQSQIAL
NEKLVNL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -