HPA003295

ARIH1 antibody from Atlas Antibodies
ARI, HARI, HHARI, UBCH7BP

Antibody data

Product number
HPA003295
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003295, RRID:AB_1845017
Product name
Anti-ARIH1
Provider product page
Atlas Antibodies - HPA003295
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LQHMVECIREVNEVIQNPATITRILLSHFNWDKEK
LMERYFDGNLEKLFAECHVINPSKKSRTRQMNTRS
SAQDMPCQICYLNYPNSYFTGLECGHKFCMQCWSE
YLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLI
TDSKVK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.