HPA003295

ARIH1 antibody from Sigma-Aldrich
ARI, HARI, HHARI, UBCH7BP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003295
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003295, RRID:AB_1845017
Product name
Anti-ARIH1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003295
Antibody type
Polyclonal
Antigen
Protein ariadne-1 homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQHMVECIREVNEVIQNPATITRILLSHFNWDKEK
LMERYFDGNLEKLFAECHVINPSKKSRTRQMNTRS
SAQDMPCQICYLNYPNSYFTGLECGHKFCMQCWSE
YLTTKIMEEGMGQTISCPAHGCDILVDDNTVMRLI
TDSKVK
Storage
-20C
Provider Type Product Number
- No reagents -