HPA014905

PIGO antibody from Sigma-Aldrich
DKFZp434M222, FLJ00135
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014905
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014905, RRID:AB_1855369
Product name
Anti-PIGO antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014905
Antibody type
Polyclonal
Antigen
GPI ethanolamine phosphate transferase 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LGVDHCGHKHGPHHPEMAKKLSQMDQVIQGLVERL
ENDTLLVVAGDHGMTTNGDHGGDSELEVSAALFLY
SPTAVFPSTPPEEPEVIPQVSLVPTLALLLGLPIP
FGNIGEVMAELFSGGEDSQPHSSALAQASALHLNA
QQ
Storage
-20C
Provider Type Product Number
- No reagents -