HPA021300

OXSM antibody from Atlas Antibodies
CEM1, FASN2D, FLJ20604, KS
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021300
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021300, RRID:AB_1848774
Product name
Anti-OXSM
Provider product page
Atlas Antibodies - HPA021300
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PQSEADQVATGVAIGMGMIPLEVVSETALNFQTKG
YNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVS
TACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCIS
PLSLAGF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -