HPA021337

OXSM antibody from Atlas Antibodies
CEM1, FASN2D, FLJ20604, KS

Antibody data

Product number
HPA021337
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021337, RRID:AB_1848776
Product name
Anti-OXSM
Provider product page
Atlas Antibodies - HPA021337
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RLHRRVVITGIGLVTPLGVGTHLVWDRLIGGESGI
VSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQNFVS
KSDIKSMSSPTIMAIGAAELAMKDSGWH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.