H00054995-B01

OXSM antibody from Abnova Corporation
CEM1, FASN2D, FLJ20604, KS

Antibody data

Product number
H00054995-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00054995-B01, RRID:AB_1204754
Product name
OXSM MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00054995-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human OXSM protein.
Antigen sequence
MSNCLQNFLKITSTRLLCSRLCQQLRSKRKFFGTV
PISRLHRRVVITGIGLVTPLGVGTHLVWDRLIGGE
SGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQN
FVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSE
ADQVATGVAIGMGMIPLEVVSETALNFQTKGYNKV
SPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACT
TGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSL
AGFSRARALSTNSDPKLACRPFHPKRDGFVMGEGA
AVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHIT
APDPEGEGALRCMAAALKDAGVQPEEISYINAHAT
STPLGDAAENKAIKHLFKDHAYALAVSSTKGATGH
LLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEF
DLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLC
IAGL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -