HPA021293

OXSM antibody from MilliporeSigma / Merck KGaA
CEM1, FASN2D, FLJ20604, KS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021293
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA021293, RRID:AB_1848772
Product name
Anti-OXSM antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA021293
Antibody type
Polyclonal
Antigen
3-oxoacyl- recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTL
NLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFG
FGGTNATLCIAGL
Storage
-20C
Provider Type Product Number
- No reagents -