HPA021300

OXSM antibody from Sigma-Aldrich
CEM1, FASN2D, FLJ20604, KS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021300
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021300, RRID:AB_1848774
Product name
Anti-OXSM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021300
Antibody type
Polyclonal
Antigen
3-oxoacyl- recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PQSEADQVATGVAIGMGMIPLEVVSETALNFQTKG
YNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVS
TACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCIS
PLSLAGF
Storage
-20C
Provider Type Product Number
- No reagents -