HPA017997

TUB antibody from Sigma-Aldrich
rd5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017997
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017997, RRID:AB_1858449
Product name
Anti-TUB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017997
Antibody type
Polyclonal
Antigen
Tubby protein homolog recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSDHAQDAGETAAGGGERPSGQDLRATMQRKGISS
SMSFDEDEEDEEENSSSSSQLNSNTRPSSATSRKS
VREAASAPSPTAPEQPVDVEVQDLEEFALRPAPQG
ITIKCRITRDKK
Storage
-20C
Provider Type Product Number
- No reagents -