Antibody data

Product number
H00080176-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00080176-M02, RRID:AB_1237884
Product name
SPSB1 monoclonal antibody (M02), clone 3E7
Provider product page
Abnova Corporation - H00080176-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SPSB1.
Antigen sequence
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPT
RLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKED
DKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWA
MRQRGTHAVVGVATADAPLHSVGYTTLVGNNHESW
GWDLGRNRLYHDDKNQPSKTYPAFLEPDETFIVPD
SFLVALDMDDGTLSFIVDGQYMGVAFRGLKGKKLY
PVVSAVWGHCEIRMRYLNGLDPEPLPLMDLCRRSV
RLALGRERLGEIHTLPLPASLKAYLLYQ
Isotype
IgG
Antibody clone number
3E7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -