HPA003296

SPSB1 antibody from Sigma-Aldrich
SSB-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003296
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003296, RRID:AB_1857462
Product name
Anti-SPSB1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003296
Antibody type
Polyclonal
Antigen
SPRY domain-containing SOCS box protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MGQKVTGGIKTVDMRDPTYRPLKQELQGLDYCKPT
RLDLLLDMPPVSYDVQLLHSWNNNDRSLNVFVKED
DKLIFHRHPVAQSTDAIRGKVGYTRGLHVWQITWA
MRQRGTHAVV
Storage
-20C
Provider Type Product Number
- No reagents -