HPA003298

RBM44 antibody from Atlas Antibodies
FLJ40411
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003298
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003298, RRID:AB_2284846
Product name
Anti-RBM44
Provider product page
Atlas Antibodies - HPA003298
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YRESAEDTQKHDTDEDSQQEYHSAEEQEYISNHLS
FDQTKALDISNPEVVELGNSGYEVKCASNVEDNRV
NSGSGSIISFDSLDVYGQEESLHVSKFQNSVMLRE
YHDLKHEKYKEQETNSMYHTVFDGSVLRSNSPGNQ
ESQSKSG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -