HPA003298

RBM44 antibody from Sigma-Aldrich
FLJ40411
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003298
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003298, RRID:AB_2284846
Product name
Anti-RBM44 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003298
Antibody type
Polyclonal
Antigen
RNA-binding protein 44 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YRESAEDTQKHDTDEDSQQEYHSAEEQEYISNHLS
FDQTKALDISNPEVVELGNSGYEVKCASNVEDNRV
NSGSGSIISFDSLDVYGQEESLHVSKFQNSVMLRE
YHDLKHEKYKEQETNSMYHTVFDGSVLRSNSPGNQ
ESQSKSG
Storage
-20C
Provider Type Product Number
- No reagents -