H00006455-M02
antibody from Abnova Corporation
Targeting: SH3GL1
CNSA1, EEN, MGC111371, SH3D2B, SH3P8
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006455-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006455-M02, RRID:AB_1112133
- Product name
- SH3GL1 monoclonal antibody (M02), clone 2B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SH3GL1.
- Antigen sequence
KASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKA
VTEVLARTIEYLQPNPASRAKLTMLNTVSKIRGQV
KNPGYPQSEGLLGECMIRHGKELGGESNFGDALLD
AGE- Isotype
- IgG
- Antibody clone number
- 2B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- SH3GL1 monoclonal antibody (M02), clone 2B5. Western Blot analysis of SH3GL1 expression in HeLa.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged SH3GL1 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol