H00006455-M05

SH3GL1 antibody from Abnova Corporation
CNSA1, EEN, MGC111371, SH3D2B, SH3P8

Antibody data

Product number
H00006455-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006455-M05, RRID:AB_1580584
Product name
SH3GL1 monoclonal antibody (M05), clone 1B8
Provider product page
Abnova Corporation - H00006455-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SH3GL1.
Antigen sequence
MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKE
MEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTM
LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELG
GESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFI
DPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQ
GKIPDEELRQALEKFEESKEVAETSMHNLLETDIE
QVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMR
EASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTA
PKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALY
DFEPENDGELGFHEGDVITLTNQIDENWYEGMLDG
QSGFFPLSYVEVLVPLPQ
Isotype
IgG
Antibody clone number
1B8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -