HPA021485

SH3GL1 antibody from Sigma-Aldrich
CNSA1, EEN, MGC111371, SH3D2B, SH3P8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021485
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021485, RRID:AB_1856816
Product name
Anti-SH3GL1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021485
Antibody type
Polyclonal
Antigen
Endophilin-A2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VDAQLDYHRQAVQILDELAEKLKRRMREASSRPKR
EYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSS
FRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDG
ELGFHE
Storage
-20C
Provider Type Product Number
- No reagents -