HPA018955

RNF216 antibody from Sigma-Aldrich
TRIAD3, UBCE7IP1, ZIN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018955
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018955, RRID:AB_1858500
Product name
Anti-RNF216 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018955
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase RNF216 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKETEARFPDVANGFIEEIIHFKNYYDLNVLCNFL
LENPDYPKREDRIIINPSSSLLASQDETKLPKIDF
FDYSKLTPLD
Storage
-20C
Provider Type Product Number
- No reagents -