HPA015742

STK33 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015742
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015742, RRID:AB_1857592
Product name
Anti-STK33 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015742
Antibody type
Polyclonal
Antigen
Serine/threonine-protein kinase 33 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KCPDCSSASQKDVLCVCSSKTRVPPVLVVEMSQTS
SIGSAESLISLERKKEKNINRDITSRKDLPSRTSN
VERKASQQQWGRGNFTEGKVPHIRIENGAAIEEIY
TFGRILGKGSFGIVIEATDKETETKWAIK
Storage
-20C
Provider Type Product Number
- No reagents -