Antibody data

Product number
H00140461-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00140461-M05, RRID:AB_1203975
Product name
ASB8 monoclonal antibody (M05), clone 1H1
Provider product page
Abnova Corporation - H00140461-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ASB8.
Antigen sequence
VINLIGQTPISRLVALLVRGLGTEKEDSCFELLHR
AVGHFELRKNGTMPREVARDPQLCEKLTVLCSAPG
TLKTLARYAVRRSLGLQYLPDAVKGLPLPASLKEY
LLLLE
Isotype
IgG
Antibody clone number
1H1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -