HPA003299

ASB8 antibody from Atlas Antibodies
FLJ21255, MGC5540
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003299
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003299, RRID:AB_1845072
Product name
Anti-ASB8
Provider product page
Atlas Antibodies - HPA003299
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGG
ADVNCTHGTLKPLHCACMVSDADCVELLLEKGAEV
NALDGYNRTALHYAAEKDEACVEVLLEYGANPNAL
DGNRDTPLHWAAFKNNAECVRALLESGASVNALDY
NN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -