HPA003299

ASB8 antibody from Atlas Antibodies
FLJ21255, MGC5540
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003299
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003299, RRID:AB_1233503
Product name
Anti-ASB8
Provider product page
Atlas Antibodies - HPA003299
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QSIQSKYSLSERLIRTIAAIRSFPHDNVEDLIRGG
ADVNCTHGTLKPLHCACMVSDADCVELLLEKGAEV
NALDGYNRTALHYAAEKDEACVEVLLEYGANPNAL
DGNRDTPLHWAAFKNNAECVRALLESGASVNALDY
NN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -