Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406214 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ankyrin Repeat and SOCS Box Containing 8 (ASB8) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ASB8 antibody: synthetic peptide directed towards the N terminal of human ASB8
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Zebrafish
- Host
- Rabbit
- Antigen sequence
MSSSMWYIMQSIQSKYSLSERLIRTIAAIRSFPHD
NVEDL IRGGADVNCT- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Molecular cloning and characterization of the human ASB-8 gene encoding a novel member of ankyrin repeat and SOCS box containing protein family.
Liu Y, Li J, Zhang F, Qin W, Yao G, He X, Xue P, Ge C, Wan D, Gu J
Biochemical and biophysical research communications 2003 Jan 24;300(4):972-9
Biochemical and biophysical research communications 2003 Jan 24;300(4):972-9
No comments: Submit comment
No validations: Submit validation data