Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1107965 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Kinesin Family Member 1C (KIF1C) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KIF1C antibody: synthetic peptide directed towards the C terminal of human KIF1C
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
GGGRSRGAGSAQPEPQHFQPKKHNSYPQPPQPYPA
QRPPGPRYPPYTTPP- Epitope
- C-Term
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Characterization of KIF1C, a new kinesin-like protein involved in vesicle transport from the Golgi apparatus to the endoplasmic reticulum.
Dorner C, Ciossek T, Müller S, Møller PH, Ullrich A, Lammers R
The Journal of biological chemistry 1998 Aug 7;273(32):20267-75
The Journal of biological chemistry 1998 Aug 7;273(32):20267-75
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human HeLa; WB Suggested Anti-KIF1C Antibody Titration: 2.5ug/ml. Positive Control: Hela cell lysate; KIF1C antibody - C-terminal region (AP42245PU-N) in Human HeLa cells using Western Blot
