HPA021831

KIF1C antibody from Sigma-Aldrich
SAX2, SPAX2, SPG58
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021831
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021831, RRID:AB_1852478
Product name
Anti-KIF1C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021831
Antibody type
Polyclonal
Antigen
Kinesin-like protein KIF1C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKMRELCRTYGKPDGPGDAWRAVARDVWDTVGEEE
GGGAGSGGGSEEGARGAEVEDLRAHIDKLTGILQE
VKLQNSSKDRELQALRDRMLRMERVIPLAQDHEDE
Storage
-20C
Provider Type Product Number
- No reagents -